missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109733

Invitrogen™ Human TCF21 (aa 125-179) Control Fragment Recombinant Protein

Catalog No. RP109733
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109733 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109733 Supplier Invitrogen™ Supplier No. RP109733
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144734 (PA5-144734. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The basic helix-loop-helix transcription factor TCF21/Pod1 (also called capsulin or epicardin) is involved in kidney, lung and spleen organogenesis. It is also essential for normal development of the testes and ovaries. TCF21/Pod1 is involved in the transcriptional repression of steroidogenic factor 1 (Sf1/Nr5a1/Ad4BP), an orphan nuclear receptor that regulates the expression of multiple genes (including Scc) that mediate sexual differentiation.

Specifications

Accession Number O43680
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6943
Name Human TCF21 (aa 125-179) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BHLHA23; capsulin; class A basic helix-loop-helix protein 23; epc; Epicardin; hypothetical protein LOC558148; Msf-1; MyoRa2; Pod1; pod-1; podocyte-expressed 1; TCF21; TCF-21; Transcription factor 21; zgc:123313
Common Name TCF21
Gene Symbol TCF21
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less