missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108933

Invitrogen™ Human TACC1 (aa 226-307) Control Fragment Recombinant Protein

Catalog No. RP108933
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108933 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108933 Supplier Invitrogen™ Supplier No. RP108933
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This locus may represent a breast cancer candidate gene. It is located close to FGFR1 on a region of chromosome 8 that is amplified in some breast cancers. Three transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number O75410
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6867
Name Human TACC1 (aa 226-307) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4833447E04Rik; AA960202; B230378H13Rik; Ga55; gastric cancer antigen Ga55; KIAA1103; Tacc1; Tacc1a; Taxin-1; transforming acidic coiled-coil containing protein 1; transforming acidic coiled-coil-containing protein 1; transforming, acidic coiled-coil containing protein 1; transforming, acidic coiled-coil containing protein 1 A
Common Name TACC1
Gene Symbol TACC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RRSKLRKPKPVPLRKKAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLGDARFQKSPPDLKETPGTLSSDTNDSGV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less