missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP94370

Invitrogen™ Human SYNC (aa 332-401) Control Fragment Recombinant Protein

Catalog No. RP94370
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94370 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94370 Supplier Invitrogen™ Supplier No. RP94370
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55817 (PA5-55817. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the intermediate filament family which contains an N-terminal head domain, followed by a central coiled-coil region and a short C-terminal tail. The protein is highly expressed in skeletal and cardiac muscle. The protein links the dystrophin associated protein complex (DAPC) to desmin filaments in muscle and may have a structural role in striated muscle. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number Q9H7C4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 81493
Name Human SYNC (aa 332-401) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110057H03Rik; intermediate filament protein syncoilin; SNIP4; SYNC; SYNC1; synci; SYNCOILIN; syncoilin intermediate filament 1; syncoilin, intermediate filament 1; syncoilin, intermediate filament protein; syncoilin-1
Common Name SYNC
Gene Symbol SYNC
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAESRQDLEEEYEPQFLRLLERKEAGTKALQRTQAEIQEMKEALRPLQAEARQLRLQNRNLEDQIALVRQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less