missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Stomatin (aa 71-184) Control Fragment Recombinant Protein

Catalog No. RP90325
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90325 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90325 Supplier Invitrogen™ Supplier No. RP90325
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52833 (PA5-52833. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Thought to regulate cation conductance. May regulate ACCN1 and ACCN3 gating.

Specifications

Accession Number P27105
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2040
Name Human Stomatin (aa 71-184) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BND7; EPB7; Epb7.2; EPB72; erythrocyte band 7 integral membrane protein; erythrocyte membrane protein band 7.2 (stomatin); erythrocyte protein band 7.2; erythrocyte protein band 7.2; protein 7.2 b; erythrocyte surface protein band 7.2; protein 7.2 b; STOM; Stomatin
Common Name Stomatin
Gene Symbol STOM
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less