missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP102227

Invitrogen™ Human SSBP1 (aa 7-146) Control Fragment Recombinant Protein

Catalog No. RP102227
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102227 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102227 Supplier Invitrogen™ Supplier No. RP102227
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51759 (PA5-51759. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein binds preferentially and cooperatively to ss-DNA. Probably involved in mitochondrial DNA replication. SSBP is a housekeeping gene involved in mitochondrial biogenesis.

Specifications

Accession Number Q04837
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6742
Name Human SSBP1 (aa 7-146) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810480P10Rik; G630031O20Rik; mtDBP; mtSSB; Mt-SSB; PWP1-interacting protein 17; single strand DNA-binding protein P16; single stranded DNA binding protein 1; single-stranded DNA binding protein 1; single-stranded DNA binding protein 1, mitochondrial; single-stranded DNA-binding protein, mitochondrial; SOSS-B1; Ssbp; Ssbp1
Common Name SSBP1
Gene Symbol Ssbp1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less