missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SPTBN1 (aa 744-869) Control Fragment Recombinant Protein

Catalog No. RP89903
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89903 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89903 Supplier Invitrogen™ Supplier No. RP89903
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53024 (PA5-53024. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Spectrin (Sp), the most abundant of the erythrocyte membrane skeleton proteins, helps these cells maintain their characteristic biconcave shape while remaining flexible and elastic. Erythrocyte Sp is a heterodimer composed of a 280 kDa alpha subunit and a 246 kDa beta subunit which associate in a side-to-side, antiparallel configuration to form a 100 nm rod-like structure. Sp in other tissues may be composed of distinct but homologous alpha and beta subunits, sometimes referred to as fodrin. A newly introduced nomenclature designates the Sp subunits of the erythrocyte as alpha-1 and beta-1, and the fodrin subunits as alpha-2 and beta-2. Alternatively spliced forms of each are designated as epsilon-1, epsilon-2, etc. (e. g. beta-1 epsilon-1).

Specifications

Accession Number Q01082
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6711
Name Human SPTBN1 (aa 744-869) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9930031C03Rik; A2a; a--fodrin; AI842465; AL033301; alpha II spectrin; alpha-fodrin; alpha-II spectrin; alpha-spectrin 2; beta fodrin; beta II spectrin-like (short form); beta-fodrin; beta-G spectrin; beta-I spectrin; Beta-II spectrin; beta-spectrin 1; beta-spectrin 2; beta-spectrin 2, non-erythrocytic; beta-spectrin II; beta-spectrin non-erythrocytic 1; betaSpII; brain alpha-spectrin; brain erythroid spectrin (235 E); brain spectrin; bSPII-; cytoskeleton protein; D330027P03Rik; EL3; ELF; elf1; elf3; embryonic liver beta-fodrin; embryonic liver fodrin; embryonic liver fodrin beta chain; epididymis luminal protein 102; erythroid spectrin beta; fodrin alpha chain; Fodrin beta chain; Gm1301; HEL102; HS2; HSPTB1; inhibitory protein factor; IPF; ja; jaundiced; membrane cytoskeletal protein; mKIAA4049; mKIAA4219; noerythroid alpha-spectrin 2; non-erythrocytic; nonerythroid alpha-spectrin 2; non-erythroid spectrin beta; short form of beta II spectrin; Sp beta; spectrin alpha chain, brain; spectrin alpha chain, non-erythrocytic 1; spectrin beta 1; spectrin beta 2; spectrin beta chain, brain 1; spectrin beta chain, erythrocyte; spectrin beta chain, erythrocytic; Spectrin beta chain, non-erythrocytic 1; spectrin beta Tandil; spectrin beta, erythrocytic; spectrin beta, non-erythrocytic 1; spectrin G; spectrin R; spectrin, alpha, non-erythrocytic 1; spectrin, beta, erythrocytic; spectrin, beta, non-erythrocytic 1; spectrin, non-erythroid alpha chain; spectrin, non-erythroid beta chain 1; SPH2; Spna2; Spnb1; Spnb-1; Spnb2; Spnb-2; Spta2; Sptan1; SPTB; SPTB1; Sptb2; Sptbn1
Common Name SPTBN1
Gene Symbol SPTBN1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less