missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP94411

Invitrogen™ Human SPATA17 (aa 184-271) Control Fragment Recombinant Protein

Catalog No. RP94411
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94411 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94411 Supplier Invitrogen™ Supplier No. RP94411
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56341 (PA5-56341. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPATA17 contains 3 IQ domains. The function of the SPATA17 protein is not known.

Specifications

Accession Number Q96L03
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 128153
Name Human SPATA17 (aa 184-271) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700065F16Rik; 4930504I07Rik; 4930513F16Rik; IQ motif containing H; IQCH; MSRG11; MSRG-11; RGD1565282; RP11-144C20.1; SPATA17; spermatogenesis associated 17; spermatogenesis-associated protein 17; Spermatogenesis-related protein 11; Srg11
Common Name SPATA17
Gene Symbol SPATA17
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KEPDPWELQLQKAKPLTHRRPKVKQKDSTSLTDWLACTSARSFPRSEILPPINRKQCQGPFRDITEVLEQRYRPLEPTLRVAEPIDEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less