missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SMAD5 (aa 229-266) Control Fragment Recombinant Protein

Catalog No. RP100022
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100022 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100022 Supplier Invitrogen™ Supplier No. RP100022
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111474 (PA5-111474. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SMADs are members of the MAD-related family of molecules. MAD-related proteins are a family of intracellular proteins that are essential components in the signaling pathways of the serine/threonine kinase receptors of the transforming growth factor beta superfamily. SMADs can be divided into receptor-regulated SMADs (R-SMADs: SMAD1, 2, 5, 8 and 9), common-mediator SMAD (co-SMAD: SMAD4), and inhibitory SMADs (I-SMADs: SMAD6 and 7). SMAD1, 5, 8 and 9 have high degrees of homology and antibodies are available that recognize sequences common to all of them. SMAD8 and SMAD9 are typically used as alternate names for one another in the literature.

Specifications

Accession Number Q99717
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4090
Name Human SMAD5 (aa 229-266) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110051M15Rik; AI451355; DKFZp781C1895; DKFZp781O1323; dwarfin-C; DWFC; Dwf-C; hSmad5; JV5-1; MAD homolog 5; MAD, mothers against decapentaplegic homolog 5; Madh5; Mothers against decapentaplegic homolog 5; mothers against decapentaplegic, drosophila, homolog of, 5; mothers against DPP homolog 5; mSmad5; MusMLP; OTTHUMP00000223331; SMA- and MAD-related protein 5; SMAD; SMAD 5; SMAD family member 5; SMAD, mothers against DPP homolog 5; SMAD5
Common Name SMAD5
Gene Symbol SMAD5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less