missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SLC7A5 (aa 16-50) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100367
Description
Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Solute carrier family 7 member 5 also known as large neutral amino acids transporter small subunit 1 is a protein that in humans is encoded by the SLC7A5 gene.It is sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc.It involved in cellular amino acid uptake and the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta.Acts as an amino acid exchanger and plays a role in neuronal cell proliferation (neurogenesis) in brain.Specifications
| Q01650 | |
| Blocking Assay, Control | |
| 8140 | |
| 100 μL | |
| 4F2; 4F2 LC; 4F2 light chain; 4F2HC; 4F2LC; 4T2HC; CD98; CD98 light chain; CD98HC; CD98LC; D0H16S474E; D16S469E; E16; hLAT1; integral membrane protein E16; large neutral amino acids transporter 1; large neutral amino acids transporter small subunit 1; LAT1; LAT-1; L-type amino acid transporter 1; MDU1; MP hLAT1; MPE16; NACAE; Protein TA1; SLC7A5; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (amino acid transporter light chain, L system), member 5; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; solute carrier family 7 member 5; Ta1; tumor-associated protein 1; y+ system cationic amino acid transporter | |
| SLC7A5 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SLC7A5 (aa 16-50) Control Fragment | |
| RUO | |
| SLC7A5 | |
| Unconjugated | |
| Recombinant | |
| AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |