missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP100367

Invitrogen™ Human SLC7A5 (aa 16-50) Control Fragment Recombinant Protein

Catalog No. RP100367
Change view
Click to view available options
Quantity:
100 μL
Catalog No. Quantity
RP100367 100 μL
1 options

Catalog No. RP100367

Supplier: Invitrogen™ RP100367

Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Solute carrier family 7 member 5 also known as large neutral amino acids transporter small subunit 1 is a protein that in humans is encoded by the SLC7A5 gene.It is sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc.It involved in cellular amino acid uptake and the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta.Acts as an amino acid exchanger and plays a role in neuronal cell proliferation (neurogenesis) in brain.

Specifications

Accession Number Q01650
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8140
Name Human SLC7A5 (aa 16-50) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4F2; 4F2 LC; 4F2 light chain; 4F2HC; 4F2LC; 4T2HC; CD98; CD98 light chain; CD98HC; CD98LC; D0H16S474E; D16S469E; E16; hLAT1; integral membrane protein E16; large neutral amino acids transporter 1; large neutral amino acids transporter small subunit 1; LAT1; LAT-1; L-type amino acid transporter 1; MDU1; MP hLAT1; MPE16; NACAE; Protein TA1; SLC7A5; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (amino acid transporter light chain, L system), member 5; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; solute carrier family 7 member 5; Ta1; tumor-associated protein 1; y+ system cationic amino acid transporter
Common Name SLC7A5
Gene Symbol SLC7A5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less