missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP100367

Invitrogen™ Human SLC7A5 (aa 16-50) Control Fragment Recombinant Protein

Catalog No. RP100367
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100367 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100367 Supplier Invitrogen™ Supplier No. RP100367
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Solute carrier family 7 member 5 also known as large neutral amino acids transporter small subunit 1 is a protein that in humans is encoded by the SLC7A5 gene.It is sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc.It involved in cellular amino acid uptake and the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta.Acts as an amino acid exchanger and plays a role in neuronal cell proliferation (neurogenesis) in brain.

Specifications

Accession Number Q01650
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8140
Name Human SLC7A5 (aa 16-50) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4F2; 4F2 LC; 4F2 light chain; 4F2HC; 4F2LC; 4T2HC; CD98; CD98 light chain; CD98HC; CD98LC; D0H16S474E; D16S469E; E16; hLAT1; integral membrane protein E16; large neutral amino acids transporter 1; large neutral amino acids transporter small subunit 1; LAT1; LAT-1; L-type amino acid transporter 1; MDU1; MP hLAT1; MPE16; NACAE; Protein TA1; SLC7A5; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (amino acid transporter light chain, L system), member 5; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; solute carrier family 7 member 5; Ta1; tumor-associated protein 1; y+ system cationic amino acid transporter
Common Name SLC7A5
Gene Symbol SLC7A5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less