missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP92793

Invitrogen™ Human SLC13A4 (aa 208-272) Control Fragment Recombinant Protein

Catalog No. RP92793
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92793 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92793 Supplier Invitrogen™ Supplier No. RP92793
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61773 (PA5-61773. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC13A4 gene ontology annotations related to this gene include sodium ion transport; transmembrane transport.

Specifications

Accession Number Q9UKG4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26266
Name Human SLC13A4 (aa 208-272) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9630060C05Rik; Na(+)/sulfate cotransporter SUT-1; NAS2; SLC13A4; sodium sulfate cotransporter-2; solute carrier family 13 (sodium/sulfate symporter), member 4; solute carrier family 13 (sodium/sulfate symporters), member 4; solute carrier family 13 (sodium/sulphate symporters), member 4; solute carrier family 13 member 4; sulphate transporter 1; SUT1; SUT-1
Common Name SLC13A4
Gene Symbol Slc13a4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLSLSI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less