missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP95846

Invitrogen™ Human SENP8 (aa 142-211) Control Fragment Recombinant Protein

Catalog No. RP95846
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95846 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95846 Supplier Invitrogen™ Supplier No. RP95846
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83318 (PA5-83318. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SENP8 (Cysteine protease FKSG8; DEN1; FKSG8; HsT17512; NEDP1; PRSC2; SUMO/sentrin specific protease family member 8), is a novel cysteine protease which belongs to the ULP family of deubiquitinases. ULP family members consist of a C-terminal core catalytic domain and N-terminal extensions determining substrate specificity. SENP8, a 24KDa protein, plays a major role in regulating NEDD8 pathway. It processes preNEDD8 to its mature form and deconjugates NEDD8 from substrates such as Cullins and p53. SENP8 may play a role in preventing accumulation of hyper-neddylated cullin and maintaining the level of mono-neddylated cullin that is thought to increase the efficiency of ubiquitination by SCF ubiquitin ligases.

Specifications

Accession Number Q96LD8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 123228
Name Human SENP8 (aa 142-211) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9130010J17Rik; AU020827; DEN1; deneddylase 1; deneddylase-1; FKSG8; NEDD8 specific-protease cysteine 2; NEDD8-specific protease 1; Nedp1; protease, cysteine 2; protease, cysteine, 2 (NEDD8 specific); PRSC2; SENP8; sentrin/SUMO-specific protease SENP8; Sentrin-specific protease 8; SUMO sentrin specific protease family member 8; SUMO/sentrin peptidase family member, NEDD8 specific; SUMO/sentrin specific peptidase 8; SUMO/sentrin specific peptidase family member 8; SUMO/sentrin specific protease 8; SUMO/sentrin specific protease family member 8; Sumo1/sentrin/SMT3 specific peptidase 8
Common Name SENP8
Gene Symbol Senp8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less