missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SCRT1 (aa 35-79) Control Fragment Recombinant Protein

Catalog No. RP100027
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100027 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100027 Supplier Invitrogen™ Supplier No. RP100027
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60966 (PA5-60966. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the Snail family of C2H2-type zinc finger transcription factors. It codes for a neural-specific transcriptional repressor that binds to E-box motifs. The protein may promote neural differention and may be involved in cancers with neuroendocrine features.

Specifications

Accession Number Q9BWW7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83482
Name Human SCRT1 (aa 35-79) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias mScrt; scratch 1; scratch family transcriptional repressor 1; scratch family zinc finger 1; scratch homolog 1 zinc finger protein; scratch homolog 1, zinc finger protein; scratch homolog 1, zinc finger protein (Drosophila); SCRT; Scrt1; Transcriptional repressor scratch 1; ZNF898
Common Name SCRT1
Gene Symbol Scrt1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYAAAVRGELGP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less