missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SARDH (aa 139-262) Control Fragment Recombinant Protein

Catalog No. RP92943
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92943 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92943 Supplier Invitrogen™ Supplier No. RP92943
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63523 (PA5-63523. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function remains known.

Specifications

Accession Number Q9UL12
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1757
Name Human SARDH (aa 139-262) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BPR-2; dimethylglycine dehydrogenase-like 1; DMGDHL1; FLJ36475; RGD:621125}; SAR; sarcosine dehydrogenase; sarcosine dehydrogenase, mitochondrial; SARD; Sardh; sardh {ECO:0000312; SDH; similar to sarcosine dehydrogenase; zgc:56363
Common Name SARDH
Gene Symbol SARDH
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGIRVWTDDFGVRRVAGVETQHGSI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less