missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108703

Invitrogen™ Human RTEL1 (aa 253-342) Control Fragment Recombinant Protein

Catalog No. RP108703
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108703 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108703 Supplier Invitrogen™ Supplier No. RP108703
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP-dependent DNA helicase implicated in telomere-length regulation, DNA repair and the maintenance of genomic stability. Acts as an anti-recombinase to counteract toxic recombination and limit crossover during meiosis. Regulates meiotic recombination and crossover homeostasis by physically dissociating strand invasion events and thereby promotes noncrossover repair by meiotic synthesis dependent strand annealing (SDSA) as well as disassembly of D loop recombination intermediates. Also disassembles T loops and prevents telomere fragility by counteracting telomeric G4-DNA structures, which together ensure the dynamics and stability of the telomere.

Specifications

Accession Number Q9NZ71
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51750
Name Human RTEL1 (aa 253-342) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI451565; AW540478; C20orf41; DEAH helicase; DKCA4; DKCB5; HAMAP-Rule:MF_03065}; helicase-like protein NHL; KIAA1088; NHL; Novel helicase-like; PFBMFT3; Regulator of telomere elongation helicase 1; regulator of telomere elongation helicase 1 {ECO:0000255; regulator of telomere length; RGD1306721; Rtel; Rtel1
Common Name RTEL1
Gene Symbol Rtel1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNMELEDIAKLKMILLRLEGAIDAVELPGDDSGVT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less