missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109414

Invitrogen™ Human RGS1 (aa 55-105) Control Fragment Recombinant Protein

Catalog No. RP109414
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109414 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109414 Supplier Invitrogen™ Supplier No. RP109414
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the regulator of G-protein signaling family. This protein is located on the cytosolic side of the plasma membrane and contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signaling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal.

Specifications

Accession Number Q08116
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5996
Name Human RGS1 (aa 55-105) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1R20; B-cell activation protein BL34; BL34; Early response protein 1R20; epididymis secretory protein Li 87; HEL-S-87; IER1; immediate-early response 1, B-cell specific; IR20; Regulator of G-protein signaling 1; regulator of G-protein signalling 1; RGS1
Common Name RGS1
Gene Symbol RGS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less