missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP106175

Invitrogen™ Human RAD9 (aa 56-170) Control Fragment Recombinant Protein

Catalog No. RP106175
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106175 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106175 Supplier Invitrogen™ Supplier No. RP106175
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RAD9 is a component of the 9-1-1 cell cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesions upon damage by the RAD17-replication factor C clamp loader complex. RAD9 acts as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair.

Specifications

Accession Number Q99638
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5883
Name Human RAD9 (aa 56-170) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Cell cycle checkpoint control protein RAD9A; chromatin-binding protein RAD9; DNA repair exonuclease rad9 homolog A; DNA repair protein RAD9; hRAD9; mRAD9; QtsA-19913; Rad9; RAD9 checkpoint clamp component A; RAD9 homolog A; RAD9 homolog A (S. pombe); Rad9a; Rad9-like protein; rCG47324-like; unnamed protein product; YD9934.02 C; YDR217C
Common Name RAD9
Gene Symbol RAD9A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LFFQQYQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less