missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90830

Invitrogen™ Human PXDC1 (aa 154-231) Control Fragment Recombinant Protein

Catalog No. RP90830
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90830 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90830 Supplier Invitrogen™ Supplier No. RP90830
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64977 (PA5-64977. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PXDC1 gene ontology annotations related to this gene include phosphatidylinositol binding.

Specifications

Accession Number Q5TGL8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 221749
Name Human PXDC1 (aa 154-231) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1300014I06Rik; C6orf145; PX domain containing 1; PX domain-containing protein 1; PX domain-containing protein C6orf145; PX domain-containing protein C6orf145 homolog; Pxdc1; RGD1311307
Common Name PXDC1
Gene Symbol PXDC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ISEIMRSNGFCLANTETIVIDHSIPNGRDQQLGVDPTEHLFENGSEFPSELEDGDDPAAYVTNLSYYHLVPFETDIWD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less