missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109017

Invitrogen™ Human PSMD2 (aa 313-404) Control Fragment Recombinant Protein

Catalog No. RP109017
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109017 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109017 Supplier Invitrogen™ Supplier No. RP109017
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. In addition to participation in proteasome function, this subunit may also participate in the TNF signalling pathway since it interacts with the tumor necrosis factor type 1 receptor. A pseudogene has been identified on chromosome 1.

Specifications

Accession Number Q13200
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5708
Name Human PSMD2 (aa 313-404) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 26 S proteasome non-ATPase regulatory subunit 2; 26 S proteasome non-ATPase regulatory subunit 2-like protein; 26 S proteasome regulatory subunit RPN1; 26 S proteasome regulatory subunit S2; 26 S proteasome subunit p97; 55.11 protein; 9430095H01Rik; AA407121; F23F1.8; I79_017809; MGC14274; P97; proteasome (prosome, macropain) 26 S subunit, non-ATPase, 2; proteasome 26 S subunit, non-ATPase 2; protein 55.11; PSMD2; RPN1; S2; TEG-190; testis expressed gene 190; Te x 190; TNFR-associated protein 2; TRAP2; Tumor necrosis factor type 1 receptor-associated protein 2
Common Name PSMD2
Gene Symbol PSMD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less