missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PSMB9 (aa 87-129) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104760
Description
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC in the immunoproteasome. Proteolytic processing is required to generate a mature subunit.Specifications
| P28065 | |
| Blocking Assay, Control | |
| 5698 | |
| 100 μL | |
| beta1i; large multifunctional peptidase 2; large multifunctional protease 2; LMP2; Lmp-2; LMP-2 d; low molecular mass polypeptide 2; low molecular mass protein 2; Macropain chain 7; MGC70470; multicatalytic endopeptidase complex chain 7; proteasome (prosome, macropain) subunit, beta type 9 (large multifunctional peptidase 2); proteasome (prosome, macropain) subunit, beta type, 9; proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2); proteasome 20 S subunit beta 9; proteasome beta 9 subunit; proteasome catalytic subunit 1 i; proteasome chain 7; proteasome subunit beta 6 i; proteasome subunit beta 9; proteasome subunit beta type 9; proteasome subunit beta type-9; Proteasome subunit beta-1 i; proteasome-related gene 2; proteosome (prosome, macropain) subunit, beta type 9; proteosome (prosome, macropain) subunit, beta type 9 (large multifunctional peptidase 2); proteosome beta 9 subunit; PSMB6i; PSMB9; Really interesting new gene 12 protein; Ring12; RING12 protein | |
| Psmb9 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PSMB9 (aa 87-129) Control Fragment | |
| RUO | |
| PSMB9 | |
| Unconjugated | |
| Recombinant | |
| GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |