missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP104760

Invitrogen™ Human PSMB9 (aa 87-129) Control Fragment Recombinant Protein

Catalog No. RP104760
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104760 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104760 Supplier Invitrogen™ Supplier No. RP104760
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC in the immunoproteasome. Proteolytic processing is required to generate a mature subunit.

Specifications

Accession Number P28065
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5698
Name Human PSMB9 (aa 87-129) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias beta1i; large multifunctional peptidase 2; large multifunctional protease 2; LMP2; Lmp-2; LMP-2 d; low molecular mass polypeptide 2; low molecular mass protein 2; Macropain chain 7; MGC70470; multicatalytic endopeptidase complex chain 7; proteasome (prosome, macropain) subunit, beta type 9 (large multifunctional peptidase 2); proteasome (prosome, macropain) subunit, beta type, 9; proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2); proteasome 20 S subunit beta 9; proteasome beta 9 subunit; proteasome catalytic subunit 1 i; proteasome chain 7; proteasome subunit beta 6 i; proteasome subunit beta 9; proteasome subunit beta type 9; proteasome subunit beta type-9; Proteasome subunit beta-1 i; proteasome-related gene 2; proteosome (prosome, macropain) subunit, beta type 9; proteosome (prosome, macropain) subunit, beta type 9 (large multifunctional peptidase 2); proteosome beta 9 subunit; PSMB6i; PSMB9; Really interesting new gene 12 protein; Ring12; RING12 protein
Common Name PSMB9
Gene Symbol Psmb9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less