missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP102909

Invitrogen™ Human PRDX3 (aa 13-93) Control Fragment Recombinant Protein

Catalog No. RP102909
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102909 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102909 Supplier Invitrogen™ Supplier No. RP102909
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111136 (PA5-111136. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Peroxiredoxin (Prx) is a growing peroxidase family, whose mammalian members have been known to connect with cell proliferation, differentiation, and apoptosis. Many isoforms (about 50 proteins), collected in accordance to the amino acid sequence homology, containing active site cysteine residue, and the thiol-specific antioxidant activity, distribute throughout all the kingdoms. Among them, mammalian Prx consists of 6 different members grouped into typical 2-Cys, atypical 2-Cys Prx, and 1-Cys Prx. Except Prx VI belonging to 1-Cys Prx subgroup, the other five 2-Cys Prx isotypes have the thioredoxin-dependent peroxidase (TPx) activity utilizing thioredoxin, thioredoxin reductase, and NADPH as a reducing system. Mammalian Prxs are 20-30 kilodalton in molecular size and vary in subcellular localization: Prx I, II, and VI in cytosol, Prx III in mitochondria, Prx IV in ER and secretion, Prx V showing complicated distribution including peroxisome, mitochondria and cytosol.

Specifications

Accession Number P30048
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10935
Name Human PRDX3 (aa 13-93) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias antioxidant protein; antioxidant protein 1; anti-oxidant protein 1; Aop1; AOP-1; AW822249; D0Tohi1; Ef2l; HBC189; Mer5; mitochondrial thioredoxin dependent peroxide reductase; mitochondrial Trx dependent peroxide reductase; perioredoxin-3; peroxiredoxin 3; peroxiredoxin III; Peroxiredoxin-3; Prdx3; PRO1748; Protein MER5; Protein MER5 homolog; Prx; Prx 3; PRx III; Prx3; PRX-3; Prx-III; SP22; SP-22; TDXM; thioredoxin-dependent peroxide reductase, mitochondrial
Common Name PRDX3
Gene Symbol PRDX3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less