missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108657

Invitrogen™ Human PPP1R9A (aa 44-125) Control Fragment Recombinant Protein

Catalog No. RP108657
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108657 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108657 Supplier Invitrogen™ Supplier No. RP108657
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111734 (PA5-111734. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Neurabin I is a brain-specific protein which contains an F-actin binding domain, a PDZ domain, a transmembrane-protein-interacting-domain, and a coiled-coil region. As its structure suggests, neurabin I is a promiscuous protein binding to F-actin, protein phosphatase 1, TGN38, and p70 S6 kinase. Found exclusively in brain, this protein is highly concentrated in the synapse and has also been shown to be enriched in the lamellipodia of the growth cone during neuronal development. Neurabin I appears to be a bridging protein by targeting other proteins to the synapse or by linking membrane proteins to the actin cytoskeleton.

Specifications

Accession Number Q9ULJ8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55607
Name Human PPP1R9A (aa 44-125) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810430P21Rik; 4930518N04Rik; 5330407E15; A230094E16Rik; actin-binding protein neurabin; BB181831; KIAA1222; mKIAA1222; Neb1; neurabin 1; Neurabin I; neurabin-1; Neurabin-I; neural tissue-specific F-actin binding protein; neural tissue-specific F-actin-binding protein I; NRB; NRB1; NRBI; p180; PP1bp175; Ppp1r9a; Protein phosphatase 1 regulatory subunit 9 A; protein phosphatase 1, regulatory (inhibitor) subunit 9 A; protein phosphatase 1, regulatory subunit 9 A
Common Name PPP1R9A
Gene Symbol PPP1R9A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less