missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP94341

Invitrogen™ Human PPM1J (aa 405-489) Control Fragment Recombinant Protein

Catalog No. RP94341
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94341 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94341 Supplier Invitrogen™ Supplier No. RP94341
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61137 (PA5-61137. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the serine/threonine protein phosphatase. The mouse homolog of this gene apparently belongs to the protein phosphatase 2C family of genes. The exact function of this gene is not yet known.

Specifications

Accession Number Q5JR12
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 333926
Name Human PPM1J (aa 405-489) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310008J22Rik; P PP2C-zeta; PP2CZ; PP2Czeta; PP2C-zeta; PPM1J; PPP2CZ; Protein phosphatase 1 J; protein phosphatase 1 J (PP2C domain containing); protein phosphatase 2 A, catalytic subunit, zeta isoform; protein phosphatase 2 C isoform zeta; protein phosphatase 2 C zeta; protein phosphatase, Mg2+/Mn2+ dependent 1 J; protein phosphatase, Mg2+/Mn2+ dependent, 1 J
Common Name PPM1J
Gene Symbol PPM1J
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less