missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP100053

Invitrogen™ Human PNPLA5 (aa 314-392) Control Fragment Recombinant Protein

Catalog No. RP100053
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100053 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100053 Supplier Invitrogen™ Supplier No. RP100053
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62937 (PA5-62937. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the patatin-like phospholipase family; its encoded protein has been shown to inhibit transacylation. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number Q7Z6Z6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 150379
Name Human PNPLA5 (aa 314-392) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias dJ388M5; dJ388M5.4; GS2L; GS2-like protein; patatin like phospholipase domain containing 5; patatin-like phospholipase domain containing 5; patatin-like phospholipase domain-containing protein 5; PNPLA5
Common Name PNPLA5
Gene Symbol PNPLA5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LEAALKKACTRDPSRWARFWHSGPGQVLTYLLLPCTLPFEYIYFRSRRLVVWLPDVPADLWWMQGLLRNMALEVFSRTK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less