missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PMCA1 ATPase (aa 2-91) Control Fragment Recombinant Protein

Catalog No. RP89885
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89885 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89885 Supplier Invitrogen™ Supplier No. RP89885
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The calcium pump of the plasma membrane, termed PMCA ATPase, pumps calcium from the cytosol to the extracellular space. This membrane-bound enzyme is related to a number of other ATPases including the SERCA ATPase and the sodium/potassium pump. There are four different genes encoding PMCA ATPase and studies have revealed 20 isoforms of the pump generated by alternate splicing of the primary gene products. mRNA distribution studies show that gene products 1 and 4 are transcribed in most tissues, however, products 2 and 3 are more tissue specific. Transcription of the splicing variants has also been found to be tissue specific. In the pancreas, where insulin secretion is calcium dependent, the beta cells only express the 4b isoform, however the alpha and gamma cells express both 4a and 4b isoforms. Studies have also shown that different splice variants have different affinities for calcium and calmodulin.

Specifications

Accession Number P20020
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 490
Name Human PMCA1 ATPase (aa 2-91) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810442I22Rik; Atp2b1; ATPase plasma membrane Ca2+ transporting 1; ATPase, Ca++ transporting, plasma membrane 1; E130111D10Rik; plasma membrane Ca2+ pump (PMCA1b); plasma membrane calcium ATPase; Plasma membrane calcium ATPase isoform 1; plasma membrane calcium pump; Plasma membrane calcium pump isoform 1; Plasma membrane calcium-transporting ATPase 1; PMCA1; Pmca1a; Pmca1b; Pmca1c; PMCA1kb
Common Name PMCA1 ATPase
Gene Symbol ATP2B1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less