missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108645

Invitrogen™ Human PLEKHB2 (aa 144-205) Control Fragment Recombinant Protein

Catalog No. RP108645
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108645 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108645 Supplier Invitrogen™ Supplier No. RP108645
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84970 (PA5-84970. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLEKHB2 gene ontology annotations related to this gene include regulation of cell differentiation.

Specifications

Accession Number Q96CS7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55041
Name Human PLEKHB2 (aa 144-205) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310009M15Rik; AU018239; evectin 2; evectin-2; Evt2; evt-2; PH domain-containing family B member 2; Phdc; pleckstrin homology domain containing B2; pleckstrin homology domain containing, family B (evectins) member 2; pleckstrin homology domain containing, family B member 2; pleckstrin homology domain-containing family B member 2; pleckstrin homology domain-containing family B member 2-like; PLEKHB2; si:dkey-121a11.4; similar to pleckstrin homology domain containing, family B (evectins) member 2; zgc:55604
Common Name PLEKHB2
Gene Symbol PLEKHB2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less