missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP105128

Invitrogen™ Human PBRM1 (aa 1584-1681) Control Fragment Recombinant Protein

Catalog No. RP105128
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105128 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105128 Supplier Invitrogen™ Supplier No. RP105128
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84414 (PA5-84414. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology).

Specifications

Accession Number Q86U86
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55193
Name Human PBRM1 (aa 1584-1681) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310032M22Rik; 2610016F04Rik; AI507524; BAF180; BRG1-associated factor 180; glutamate receptor interacting protein 2; hPB1; LOC506557 protein; PB1; PBRM1; polybromo 1; polybromo-1 D; Protein polybromo-1; RGD1565549
Common Name PBRM1
Gene Symbol Pbrm1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNIR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less