missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109812

Invitrogen™ Human PBOV1 (aa 71-108) Control Fragment Recombinant Protein

Catalog No. RP109812
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109812 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109812 Supplier Invitrogen™ Supplier No. RP109812
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144975 (PA5-144975. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This intronless gene encodes a protein of unknown function. Its expression is up-regulated in some types of cancer, including prostate, breast, and bladder cancer. [provided by RefSeq, Aug 2011].

Specifications

Accession Number Q9GZY1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 59351
Name Human PBOV1 (aa 71-108) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias dJ171N11.2; PBOV1; prostate and breast cancer overexpressed 1; prostate and breast cancer overexpressed gene 1 protein; Protein UROC28; UC28; UROC28
Common Name PBOV1
Gene Symbol PBOV1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YSIEQSHHAILTPLQTHLTMKGSSMKCSSLSSEAILFT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less