missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP102409

Invitrogen™ Human p41-ARCb (aa 225-365) Control Fragment Recombinant Protein

Catalog No. RP102409
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102409 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102409 Supplier Invitrogen™ Supplier No. RP102409
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52119 (PA5-52119. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1A. The similarity between these two proteins suggests that they both may function as p41 subunit of the human Arp2/3 complex that has been implicated in the control of actin polymerization in cells. It is possible that the p41 subunit is involved in assembling and maintaining the structure of the Arp2/3 complex. Multiple versions of the p41 subunit may adapt the functions of the complex to different cell types or developmental stages. This protein also has a role in centrosomal homeostasis by being an activator and substrate of the Aurora A kinase.

Specifications

Accession Number O15143
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10095
Name Human p41-ARCb (aa 225-365) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 41 kDa; AA408064; AA408534; AA571392; actin related protein 2/3 complex subunit 1 B; actin related protein 2/3 complex subunit 1 B, 41 kDa; actin related protein 2/3 complex, subunit 1 B; actin related protein 2/3 complex, subunit 1 B, 41 kDa; actin-related protein 2/3 complex subunit 1 B; Actin-related protein complex 1 b; AF007010; ARC41; Arp2/3 complex 41 kDa subunit; ARP2/3 protein complex subunit p41; Arpc1b; AW208418; L72; OTTHUMP00000206020; p40-ARC; p41-ARC; SOP2Hs
Common Name p41-ARCb
Gene Symbol ARPC1B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less