missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP101019

Invitrogen™ Human ODF2 (aa 39-181) Control Fragment Recombinant Protein

Catalog No. rp101019
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101019 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101019 Supplier Invitrogen™ Supplier No. RP101019
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51649 (PA5-51649. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly.

Specifications

Accession Number Q5BJF6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4957
Name Human ODF2 (aa 39-181) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 84 kDa outer dense fiber protein; AI848335; cancer/testis antigen 134; cenexin; cenexin 1; CT134; KKT4; MMTEST29; ODF2; ODF2/1; ODF2/2; Odf84; outer dense fiber of sperm tail 2; outer dense fiber of sperm tails 2; outer dense fiber of sperm tails protein 2; outer dense fiber of sperm tails, 84-kD; outer dense fiber protein 2; RP11-187B3.1; sperm outer dense fiber major protein 2; sperm tail structural protein; testis tissue sperm-binding protein Li 51 e; testis-specific autoantigen
Common Name ODF2
Gene Symbol ODF2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less