missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP97704

Invitrogen™ Human OAS3 (aa 69-166) Control Fragment Recombinant Protein

Catalog No. RP97704
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97704 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97704 Supplier Invitrogen™ Supplier No. RP97704
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59494 (PA5-59494. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OAS3 is an interferon inducible protein that belongs to the 2-5A synthetase family, may play a role in mediating resistance to virus infection, control of cell growth, differentiation, and apoptosis. OAS3 synthesizes preferentially dimeric 2',5'-oligoadenylate molecules. GTP can be an alternative substrate. OAS3 binds double-stranded RNA and polymerizes ATP into PPP(A2'P5'A)N oligomers, which activate the latent RNase L that, when activated, cleaves single-stranded RNAs. The protein is present at high level in placenta trophoblast.

Specifications

Accession Number Q9Y6K5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4940
Name Human OAS3 (aa 69-166) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias (2-5')oligo(A) synthase 3; (2-5')oligo(A) synthetase 3; 2',5'-oligoadenylate synthetase-like 10; 2'-5' oligoadenylate synthetase 3; 2'-5' oligoadenylate synthetase-like 10; 2-5 A synthase 3; 2-5 A synthetase 3; 2'-5'-oligoadenylate synthase 3; 2'-5'-oligoadenylate synthetase 3; 2'-5'-oligoadenylate synthetase 3, 100 kDa; 2'-5'oligoadenylate synthetase p100; Oas3; oasl10; P/OKcl0.4; p100; p100 OAS; p100OAS
Common Name OAS3
Gene Symbol OAS3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less