missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP97454

Invitrogen™ Human NUDT8 (aa 70-137) Control Fragment Recombinant Protein

Catalog No. RP97454
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97454 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97454 Supplier Invitrogen™ Supplier No. RP97454
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59580 (PA5-59580. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.

Specifications

Accession Number Q8WV74
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 254552
Name Human NUDT8 (aa 70-137) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310039H17Rik; Nucleoside diphosphate-linked moiety x motif 8; nucleoside diphosphate-linked moiety x motif 8, mitochondrial; nudix (nucleoside diphosphate linked moiety X)-type motif 8; nudix hydrolase 8; nudix motif 8; nudix-type motif 8; Nudt8
Common Name NUDT8
Gene Symbol Nudt8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVLAGVGPLDPQSLRPNSEEVD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less