missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90078

Invitrogen™ Human Nope (aa 1036-1172) Control Fragment Recombinant Protein

Catalog No. RP90078
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90078 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90078 Supplier Invitrogen™ Supplier No. RP90078
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52580 (PA5-52580. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

Accession Number Q8TDY8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57722
Name Human Nope (aa 1036-1172) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias amplimer WI-16786, mouse homolog; amplimer WI-18508, mouse homolog; DDM36; hDDM36; Igdcc4; Immunoglobulin superfamily DCC subclass member 4; immunoglobulin superfamily, DCC subclass, member 4; Kiaa1628; likely ortholog of mouse neighbor of Punc E11; LOC57722; neighbor of Punc E11; neighbor of Punc e11 protein; Nope; NOPEFLJ42051; Protein DDM36
Common Name Nope
Gene Symbol IGDCC4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VEDRAEVHSLMGGGVSEGRSHSKRKISWAQPSGLSWAGSWAGCELPQAGPRPALTRALLPPAGTGQTLLLQALVYDAIKGNGRKKSPPACRNQVEAEVIVHSDFSASNGNPDLHLQDLEPEDPLPPEAPDLISGVGD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less