missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP89824

Invitrogen™ Human NEK10 (aa 338-465) Control Fragment Recombinant Protein

Catalog No. RP89824
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89824 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89824 Supplier Invitrogen™ Supplier No. RP89824
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58601 (PA5-58601. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NEK10 (NIMA Related Kinase 10) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene includetransferase activity, transferring phosphorus-containing groupsandprotein tyrosine kinase activity.

Specifications

Accession Number Q6ZWH5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 152110
Name Human NEK10 (aa 338-465) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FLJ32685; NEK10; Never in mitosis A-related kinase 10; NIMA (never in mitosis gene a)- related kinase 10; NIMA related kinase 10; NIMA-related kinase 10; nimA-related protein kinase 10; Serine/threonine-protein kinase Nek10
Common Name NEK10
Gene Symbol NEK10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LHILQGDRNFVSDHSSIGSLSSANAAGRIQQLHLSEDLSPREIQENTFSLQAACCAALTELVLNDTNAHQVVQENGVYTIAKLILPNKQKNAAKSNLLQCYAFRALRFLFSMERNRPLFKRLFPTDLF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less