missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90839

Invitrogen™ Human NECAB2 (aa 64-198) Control Fragment Recombinant Protein

Catalog No. RP90839
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90839 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90839 Supplier Invitrogen™ Supplier No. RP90839
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53108 (PA5-53108. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a neuronal calcium-binding protein that binds to and modulates the function of at least two receptors, adenosine A(2A) receptor and metabotropic glutamate receptor type 5.

Specifications

Accession Number Q7Z6G3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54550
Name Human NECAB2 (aa 64-198) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias EF hand calcium binding protein 2; Efcbp2; EF-hand calcium binding protein 2; EF-hand calcium-binding protein 2; NECAB2; neuronal calcium binding 2; neuronal calcium-binding protein 2; N-terminal EF-hand calcium binding protein 2; N-terminal EF-hand calcium-binding protein 2; Stip-2; synaptotagmin-interacting protein 2
Common Name NECAB2
Gene Symbol NECAB2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less