missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP102229

Invitrogen™ Human NDUFS3 (aa 71-217) Control Fragment Recombinant Protein

Catalog No. RP102229
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102229 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102229 Supplier Invitrogen™ Supplier No. RP102229
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82155 (PA5-82155. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of the iron-sulfur protein components of mitochondrial NADH:ubiquinone oxidoreductase. Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

Specifications

Accession Number O75489
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4722
Name Human NDUFS3 (aa 71-217) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610010M09Rik; CI-30; CI-30 kD; complex I 30 kDa subunit; complex I-30 kD; hypothetical protein LOC550451; NADH dehydrogenase (ubiquinone); NADH dehydrogenase (ubiquinone) Fe-S protein 3; NADH dehydrogenase (ubiquinone) Fe-S protein 3, (NADH-coenzyme Q reductase); NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30 kDa (NADH-coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial; NADH dehydrogenase-ubiquinone 30 kDa subunit; NADH:ubiquinone oxidoreductase core subunit S3; NADH-ubiquinone oxidoreductase 30 kDa subunit; NDUFS3; zgc:112520
Common Name NDUFS3
Gene Symbol NDUFS3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less