missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP95186

Invitrogen™ Human NDUFA1 (aa 27-65) Control Fragment Recombinant Protein

Catalog No. rp95186
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95186 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95186 Supplier Invitrogen™ Supplier No. RP95186
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65049 (PA5-65049, PA5-62951 (PA5-62951. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Specifications

Accession Number O15239
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4694
Name Human NDUFA1 (aa 27-65) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810049F12Rik; CI-MWFE; complex I MWFE subunit; complex I-MWFE; MWFE; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5 kD, MWFE); NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5 kDa; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1; NADH dehydrogenase 1 alpha subcomplex, 1; NADH oxidoreductase subunit MWFE; NADH ubiquinone oxidoreductase subunit MWFE; NADH:ubiquinone oxidoreductase (complex 1); NADH:ubiquinone oxidoreductase subunit A1; NADH-ubiquinone oxidoreductase MWFE subunit; NDUFA1; RGD1560955; type I dehydrogenase; ZNF183
Common Name NDUFA1
Gene Symbol NDUFA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less