missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90219

Invitrogen™ Human NDFIP1 (aa 17-64) Control Fragment Recombinant Protein

Catalog No. RP90219
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90219 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90219 Supplier Invitrogen™ Supplier No. RP90219
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52674 (PA5-52674. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The NEDD4 family-interacting protein 1 (NDFIP1) belongs to a small group of evolutionarily conserved proteins with three transmembrane domains and is an integral Golgi membrane protein. It is a potential target for ubiquitination by the Nedd4 family of proteins. NDFIP1 is strongly expressed in surviving neurons following acute cortical brain injury, and overexpression in cultured cortical neurons increased survival following growth factor starvation, suggesting that NDFIP1 may play a role in neuronal survival. NDFIP1 and the related protein NDFIP2 are thought to interact with and regulate multiple components of the EGF and PTEN/Akt signaling pathways. Recent studies suggest that NDFIP1 may also play a role in Th17 differentiation by limiting the production of proinflammatory cytokines.

Specifications

Accession Number Q9BT67
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80762
Name Human NDFIP1 (aa 17-64) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610010M22Rik; Breast cancer-associated protein SGA-1 M; N4wbp5; Ndfip1; Nedd4 family interacting protein 1; NEDD4 family-interacting protein 1; Nedd4 WW binding protein 5; NEDD4 WW domain-binding protein 5; Nedd4 WW-binding protein 5; PSEC0192; PSEC0223; Putative MAPK-activating protein PM13; putative NF-kappa-B-activating protein 164; Putative NFKB and MAPK-activating protein
Common Name NDFIP1
Gene Symbol NDFIP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less