missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109411

Invitrogen™ Human NAT13 (aa 1-51) Control Fragment Recombinant Protein

Catalog No. RP109411
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109411 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109411 Supplier Invitrogen™ Supplier No. RP109411
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NAT13 is a probable catalytic component of the ARD1A-NARG1 complex which displays alpha (N-terminal) acetyltransferase activity.

Specifications

Accession Number Q9GZZ1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80218
Name Human NAT13 (aa 1-51) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2600005K24Rik; 2810441M03Rik; AW112078; hNaa50p; hNAT5; hSAN; MAK3; Mak3 homolog; Mak3p; Mak3p homolog; N(alpha)-acetyltransferase 50, NatE catalytic subunit; Naa50; N-acetyltransferase 13; N-acetyltransferase 13 (GCN5-related); N-acetyltransferase 5; N-acetyltransferase NAT13; N-acetyltransferase san homolog; Nalpha acetyltransferase 50; N-alpha-acetyltransferase 50; N-alpha-acetyltransferase 50, NatE catalytic subunit; Nat13; NAT13P; Nat5; NAT5P; NatE catalytic subunit; N-epsilon-acetyltransferase 50; San
Common Name NAT13
Gene Symbol NAA50
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less