missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108812

Invitrogen™ Human MYO6 (aa 554-646) Control Fragment Recombinant Protein

Catalog No. RP108812
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108812 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108812 Supplier Invitrogen™ Supplier No. RP108812
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein involved intracellular vesicle and organelle transport, especially in the hair cell of the inner ear. Mutations in this gene have been found in patients with non-syndromic autosomal dominant and recessive hearing loss.

Specifications

Accession Number Q9UM54
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4646
Name Human MYO6 (aa 554-646) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC029719; DFNA22; DFNB37; KIAA0389; MYO6; myosin; myosin VI; myosin-VI; RGD1560646; Snell's waltzer; sv; tailchaser; Tlc; unconventional myosin; unconventional myosin-6; Unconventional myosin-VI
Common Name MYO6
Gene Symbol MYO6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESRDKFIRELFESSTNNNKDTKQKAGKLSFISVGNK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less