missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MXI1 (aa 22-98) Control Fragment Recombinant Protein

Catalog No. RP108811
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108811 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108811 Supplier Invitrogen™ Supplier No. RP108811
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

It is now well established that Myc regulation of cell proliferation and differentiation involves a family of related transcription factors. One such factor, Max, is an obligate heterodimeric partner for Myc and can also form heterodimers with at least four related proteins designated Mad 1, Mxi1, Mad 3 and Mad 4. Like Mad 1 and Mxi1, association of Mad 3 and Mad 4 with Max results in transcriptional repression. Both Myc and the Mad proteins have short half-lives and their synthesis is tightly regulated, while Max expression is constitutive and relatively stable. Two related mammalian cDNAs have been identified and shown to encode Mad-binding proteins. Both possess sequence homology with the yeast transcription repressor Sin3 including four conserved paired amphipathic helix (PAH) domains. mSin3A and mSin3B specifically interact with the Mad proteins via their second paired amphipathic helix domain (PAH2). It has been suggested that Mad-Max heterodimers repress transcription by tethering mSin3 to DNA as corepressors.

Specifications

Accession Number P50539
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4601
Name Human MXI1 (aa 22-98) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bHLHc11; class C basic helix-loop-helix protein 11; ENSMUSG00000067085; Gm10197; Mad2; MAX dimerization protein 2; Max interacting protein 1; MAX interactor 1; MAX interactor 1, dimerization protein; max-interacting protein 1; Max-interacting protein 1-like protein; Max-related transcription factor; MGC43220; MXD2; MXI; MXI1; MXI-WR; RP11-549L6.1
Common Name MXI1
Gene Symbol Mxi1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less