missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP107606

Invitrogen™ Human MTUS1 (aa 429-513) Control Fragment Recombinant Protein

Catalog No. RP107606
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107606 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107606 Supplier Invitrogen™ Supplier No. RP107606
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66961 (PA5-66961. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase family. It is located in endoplasmic reticulum and acts as molecular chaperones.

Specifications

Accession Number Q9ULD2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57509
Name Human MTUS1 (aa 429-513) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI481402; angiotensin II AT2 receptor-interacting protein 1; angiotensin-II type 2 receptor-interacting protein; AT2 receptor-binding protein; AT2 receptor-interacting protein; AT2 receptor-interacting protein 1; AT2R binding protein; ATBP; ATBP135; ATIP; Atip1; Atip3b; ATIP4; B430010I23Rik; B430305I03Rik; C85752; Cctsg1; Cctsg1-440; Coiled-coiled tumor suppressor gene 1 protein; coiled-coiled tumor supressor gene 1; DKFZp586D1519; DKFZp686F20243; erythroid differentiation-related; FLJ14295; GK1; growth factor inhibitor; ICIS; KIAA1288; MD44; microtubule associated scaffold protein 1; microtubule associated tumor suppressor 1; microtubule-associated tumor suppressor 1; Microtubule-associated tumor suppressor 1 homolog; mitochondrial tumor suppressor 1; Mitochondrial tumor suppressor 1 homolog; mitochondrial tumor suppressor gene 1; mKIAA1288; MP44; MTSG1; Mtus1; transcription factor MTSG1
Common Name MTUS1
Gene Symbol MTUS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence STPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less