missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP92815

Invitrogen™ Human MTURN (aa 1-53) Control Fragment Recombinant Protein

Catalog No. RP92815
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92815 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92815 Supplier Invitrogen™ Supplier No. RP92815
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56177 (PA5-56177. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

Accession Number Q8N3F0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 222166
Name Human MTURN (aa 1-53) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C7orf41; ch211-149a19.1; Ells1; Maturin; maturin neural progenitor differentiation regulator protein homolog; maturin, neural progenitor differentiation regulator homolog (Xenopus); MTURN; Protein Ells1; si:ch211-149a19.1; UPF0452 protein C7orf41; UPF0452 protein C7orf41 homolog
Common Name MTURN
Gene Symbol MTURN
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less