missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP100669

Invitrogen™ Human MOX1 (aa 19-150) Control Fragment Recombinant Protein

Catalog No. RP100669
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100669 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100669 Supplier Invitrogen™ Supplier No. RP100669
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83765 (PA5-83765. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MEOX1 belongs to a family of nonclustered, diverged homeobox genes. It may play a role in regulating growth and differentiation.

Specifications

Accession Number P50221
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4222
Name Human MOX1 (aa 19-150) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI385561; D330041M02Rik; GP91-2; homeobox protein MOX-1; KFS2; MEOX1; Mesenchyme homeobox 1; mitogenic oxidase 1; MOX1; Mox-1; NOH1; NOH-1; NOX-1
Common Name MOX1
Gene Symbol MEOX1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less