missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MFAP3L (aa 333-408) Control Fragment Recombinant Protein

Catalog No. RP108115
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108115 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108115 Supplier Invitrogen™ Supplier No. RP108115
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139856 (PA5-139856. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MFAP3L is a protein coding gene. May participate in the nuclear signaling of EGFR and MAPK1/ERK2. May a have a role in metastasis.

Specifications

Accession Number O75121
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9848
Name Human MFAP3L (aa 333-408) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933428A15Rik; 5430405D20Rik; AI461995; AW125052; HSD39; HSD-39; KIAA0626; Mfap3l; microfi brillar-associated protein 3-like; microfibril associated protein 3 like; microfibrillar associated protein 3 like; microfibrillar-associated protein 3-like; mKIAA0626; NYD-sp9; Testis development protein NYD-SP9
Common Name MFAP3L
Gene Symbol MFAP3L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QEGGQFEVKDVEETELSAEHSPETAEPSTDVTSTELTSEEPTPVEVPDKVLPPAYLEATEPAVTHDKNTCIIYESH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less