missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP104904

Invitrogen™ Human METTL1 (aa 60-132) Control Fragment Recombinant Protein

Catalog No. RP104904
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104904 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104904 Supplier Invitrogen™ Supplier No. RP104904
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65621 (PA5-65621. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.

Specifications

Accession Number Q9UBP6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4234
Name Human METTL1 (aa 60-132) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810012D02Rik; C12orf1; D1075-like gene product; hypothetical protein LOC449779; methyltransferase like 1; methyltransferase-like 1; methyltransferase-like protein 1; METTL1; miRNA (guanine-N(7)-)-methyltransferase; mRNA (guanine-N(7)-)-methyltransferase; TRM8; TRMT8; tRNA (guanine(46)-N(7))-methyltransferase; tRNA (guanine-N(7)-)-methyltransferase; tRNA (guanine-N(7)-)-methyltransferase-like protein; tRNA(m7G46)-methyltransferase; Unknown (protein for MGC:134433); YDL201w; zgc:103636
Common Name METTL1
Gene Symbol Mettl1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less