missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP95862

Invitrogen™ Human METAP1D (aa 70-146) Control Fragment Recombinant Protein

Catalog No. RP95862
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95862 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95862 Supplier Invitrogen™ Supplier No. RP95862
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56434 (PA5-56434. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The N-terminal methionine excision pathway is an essential process in which the N-terminal methionine is removed from many proteins, thus facilitating subsequent protein modification. In mitochondria, enzymes that catalyze this reaction are celled methionine aminopeptidases (MetAps, or MAPs; EC 3.4.11.18).

Specifications

Accession Number Q6UB28
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 254042
Name Human METAP1D (aa 70-146) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310066F24Rik; 3110033D18Rik; AV117938; CDS of metAP-3 within PCR fragment; MAP 1 D; Map1d; MetAP 1 D; METAP1D; Metap1l; Metapl1; methionine aminopeptidase 1 D, mitochondrial; methionine aminopeptidase-like 1; methionyl aminopeptidase type 1 D (mitochondrial); methionyl aminopeptidase type 1 D, mitochondrial; Mnpepl; Peptidase M 1 D
Common Name METAP1D
Gene Symbol METAP1D
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less