missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP104804

Invitrogen™ Human MCM8 (aa 116-260) Control Fragment Recombinant Protein

Catalog No. RP104804
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104804 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104804 Supplier Invitrogen™ Supplier No. RP104804
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65399 (PA5-65399. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Specifications

Accession Number Q9UJA3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84515
Name Human MCM8 (aa 116-260) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730432L01Rik; C20orf154; dJ967N21.5; DNA helicase MCM8; DNA replication licensing factor MCM8; MCM8; MCM8 minichromosome maintenance deficient 8; MGC119522; MGC119523; MGC12866; MGC4816; minichromosome maintenance 8; minichromosome maintenance 8 homologous recombination repair factor; minichromosome maintenance complex component 8; minichromosome maintenance deficient 8; minichromosome maintenance deficient 8 (S. cerevisiae); POF10; REC; REC homolog
Common Name MCM8
Gene Symbol MCM8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDGKYSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less