missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109690

Invitrogen™ Human MCAK (aa 3-90) Control Fragment Recombinant Protein

Catalog No. RP109690
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109690 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109690 Supplier Invitrogen™ Supplier No. RP109690
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140304 (PA5-140304. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import.

Specifications

Accession Number Q99661
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11004
Name Human MCAK (aa 3-90) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930402F02Rik; CT139; ESTM5; hypothetical protein; KIF2C; kinesin family member 2 C; kinesin-like 6; kinesin-like protein 6; Kinesin-like protein KIF2C; kinesin-related protein 2; KNSL6; KRP2; MCAK; Mitotic centromere-associated kinesin; QtsA-16015; RP11-269F19.1; testis tissue sperm-binding protein Li 68 n; X83316
Common Name MCAK
Gene Symbol KIF2C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less