missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MBD3L1 (aa 82-152) Control Fragment Recombinant Protein

Catalog No. rp99180
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99180 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99180 Supplier Invitrogen™ Supplier No. RP99180
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (41%), Rat (41%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61306 (PA5-61306. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein is localized to discrete areas in the nucleus, and expression appears to be restricted to round spermatids, suggesting that the protein plays a role in the postmeiotic stages of male germ cell development.

Specifications

Accession Number Q8WWY6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 85509
Name Human MBD3L1 (aa 82-152) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700070G05Rik; 1700095H13Rik; LOC100717039; Mbd3l; MBD3L1; MBD3-like protein 1; methyl-CpG binding domain protein 3 like 1; methyl-CpG binding domain protein 3-like 1; methyl-CpG-binding domain protein 3-like 1; Unknown (protein for MGC:137086)
Common Name MBD3L1
Gene Symbol MBD3L1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less